Skip to content

CDC7/DBF4 Kinase Enzyme System

by Promega
€ 455.35
Size

Recombinant full-length human CDC7 and DBF4 proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDC7 is a cell division cycle 7 homolog protein that is critical for the G1/S transition and is also essential for initiation of DNA replication as cell division occurs. CDC7 is expressed in many normal tissues, but the overexpression of CDC7 may be associated with neoplastic transformation for some tumors and transformed cell lines. CDC7/DBF4 kinase promotes S phase by alleviating an inhibitory activity in Mcm4 that evolved to integrate several protein kinase. ADP-Glo Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted into ATP, which is a substrate in a reaction catalyzed by Ultra-Glo Luciferase that produces light. The luminescent signal positively correlates with ADP amount and kinase activity. The assay is well suited for measuring the effects chemical compounds have on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase or ATPase) using up to 1mM ATP. Kinase Enzyme System contains: Kinase: CDC7/DBF4 , 10microg (Human, recombinant full-length). MW: ~94kDa (CDC7) and ~125kDa (DBF4). Substrate: PDKtide ([protein fragment, 39 aa]); derived from two human proteins: residues 1-14 are based on AKT1 (307-320), and residues 16-39 are based on PKN2/PRK2 (961-984). Other: Reaction Buffer, DTT. CDC7/DBF4 NCBI Database Entry: www.ncbi.nlm.nih.gov/gene/8317/. Visit www.promega.com/kinase/ to see all Kinase Enzyme Systems.