CDK9/CyclinK Kinase Enzyme System

by Promega
Available SKUs: V4104 |
Login to view price.


  • Overview
  • Protocols
  • Specifications
  • Resources
  • Kinase-background-v2light

    Convenient, Scalable Kinase Profiling

    The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer and supplemental reagents as needed. The CDK9/CyclinK Kinase Enzyme System contains:

    • CDK9/CyclinK Kinase, 10ug (Human, recombinant full-length). MW: ~68kDa (CDK9) and ~67kDa (CyclinK).
    • PDKtide ([protein fragment, 39 aa]) Substrate; residues 1–14 are derived from AKT1 (307–320), and residues 16–39 are derived from PKN2/PRK2 (961–984).
    • Reaction Buffer, DTT.

    Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9/CyclinK is a member of the cyclin-dependent protein kinase (CDK) family. CDK9 is closely related to cdc28 and cdc2 and is an important regulator of the cell cycle. CDK9 is a component of the multiprotein complex TAK/P-TEF?. CDK9 can modulate RNA polymerase II-directed transcription by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. CDK9 forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. CDK9 also interacts with the HIV-1 Tat protein, which suggests a possible involvement of this protein in AIDS.

    CDK9/CyclinK NCBI Database Entry.

    The CDK9/CyclinK Kinase Enzyme System can be purchased with or without the ADP-Glo™ Kinase Assay reagents. Used together, the ADP-Glo™ Kinase Assay + Kinase Enzyme Systems provide a convenient method for profiling the effect of lead compounds on kinase activity. Assay advantages include broad dynamic range, ease of use and high sensitivity. Kinase Enzyme Systems are manufactured by SignalChem. Bulk quantities available upon request.

    Use with ADP-Glo™ Kinase Assay

    The ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted into ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount and kinase activity. The assay is well suited for measuring the effects of chemical compounds on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase or ATPase) using up to 1mM ATP.


    See all Kinase Enzyme Systems available from Promega.

  • Protocols

    Complete Protocol

    Download PDF

    CDK9/CyclinK Kinase Enzyme Protocol

    PDF (919 KB)

  • Certificate of Analysis

    Lookup Certificate of Analysis

    Storage Conditions

    LESS THAN -65C

    Use Restrictions

    For Research Use Only. Not for Use in Diagnostic Procedures.

  • Resources



You recently viewed

Clear recently viewed